Home » Listings » Barnesville Family Health & Wellness

Barnesville Family Health & Wellness

 Medical

Our goal is to provide our patients with the perfect combination of quality care and advanced technology available in Barnesville, GA.

Contact details

  

Please complete the captcha field below to view phone number and/or email address.

 http://barnesvillefamilyhealthwellness.com

WHOIS

  1. Created on: 02/01/2022, 12:50PM
  2. Last Updated on: 02/02/2026, 07:03AM
  3. Expires on: 02/01/2028, 12:50PM
  4. Registrant:
    • Organization: Domains By Proxy, LLC
    • State: Arizona
    • Country: UNITED STATES
    • Country Code: US
  5. Technical Contact:
    • Organization: Domains By Proxy, LLC
    • State: Arizona
    • Country: UNITED STATES
    • Country Code: US
  6. Domain Name: barnesvillefamilyhealthwellness.com
  7. Name Servers:
    • Host Names: NS13.DOMAINCONTROL.COM, NS14.DOMAINCONTROL.COM
  8. Audit:
    • Created on: 03/27/2026, 12:08PM
    • Last Updated on: 03/27/2026, 12:08PM
  9. Registrar: GoDaddy.com, LLC
  10. Registrar IANAID: 146
  11. WHOIS Server: whois.godaddy.com
  12. Contact Email: abuse@godaddy.com